PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00047.1_g00031.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 328aa    MW: 37781.9 Da    PI: 6.1046
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00047.1_g00031.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.34.3e-191461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEde+l+d ++++G g+W++ ++  g++R++k+c++rw +yl
  Rsa1.0_00047.1_g00031.1 14 KGPWTQEEDEKLIDHIQKHGHGSWRALPKQAGLNRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding56.37.1e-1867112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++T+eE+e +++++ +lG++ W++Ia+ ++ +Rt++++k++w+++l
  Rsa1.0_00047.1_g00031.1  67 RGNFTEEEEETIINLHSLLGNK-WSSIASNLP-RRTDNEIKNYWNTHL 112
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.613961IPR017930Myb domain
SuperFamilySSF466891.47E-3111108IPR009057Homeodomain-like
SMARTSM007176.9E-161363IPR001005SANT/Myb domain
PfamPF002492.2E-171461IPR001005SANT/Myb domain
CDDcd001672.09E-121661No hitNo description
PROSITE profilePS5129427.23462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2665116IPR009057Homeodomain-like
SMARTSM007175.9E-1766114IPR001005SANT/Myb domain
PfamPF002491.9E-1667112IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTQE EDEKLIDHIQ KHGHGSWRAL PKQAGLNRCG KSCRLRWTNY  60
LRPDIKRGNF TEEEEETIIN LHSLLGNKWS SIASNLPRRT DNEIKNYWNT HLRKRLLQME  120
IDPMTHRPRT DHLNVLAALP QLIAAANFNS LLNLSQNVQL DATTLAQAQF LHNMIQVIST  180
NNNNNPSSAP LAMQTNNNLF GRQSSYLENQ NLFGQSQNFS QIFENSRHDE DFIVKNQTID  240
HPLDYFSSPI QMDVQDDPYS LPLLVPDSPE ESKQSQMMIK NKDIVQHHRH DTSNPSSSNS  300
SFTQDHHQPW CDTIDDEASD SYWKDIIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-301211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610486.10.0PREDICTED: myb-related protein 330
TrEMBLA0A0D3EEY00.0A0A0D3EEY0_BRAOL; Uncharacterized protein
STRINGAT5G16770.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.21e-173myb domain protein 9